General Information

  • ID:  hor003145
  • Uniprot ID:  P01302
  • Protein name:  Pancreatic hormone
  • Gene name:  PPY
  • Organism:  Bos taurus (Bovine)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  APLEPEYPGDNATPEQMAQYAAELRRYINMLTRPRY
  • Length:  36(30-65)
  • Propeptide:  MAAAHRCLFLLLLSTCVALLLQPPLGALGAPLEPEYPGDNATPEQMAQYAAELRRYINMLTRPRYGKRDKEGTLDFLECGSPHSAVPRYGKRDKEGTLDFLECGSPHSAVPRWVFSLSCVPRCLGQENGGV
  • Signal peptide:  MAAAHRCLFLLLLSTCVALLLQPPLGALG
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts as a regulator of pancreatic and gastrointestinal functions
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  1bba(PDB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    1bba.pdbhor003145_AF2.pdbhor003145_ESM.pdb

Physical Information

Mass: 485121 Formula: C186H286N52O57S2
Absent amino acids: CFHKSVW Common amino acids: AP
pI: 4.71 Basic residues: 4
Polar residues: 9 Hydrophobic residues: 9
Hydrophobicity: -99.44 Boman Index: -9133
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 57.22
Instability Index: 6709.44 Extinction Coefficient cystines: 5960
Absorbance 280nm: 170.29

Literature

  • PubMed ID:  7831336
  • Title:  Seminalplasmin: Recent Evolution of Another Member of the Neuropeptide Y Gene Family